PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g30885.1.p
Common NameBRADI_4g30885
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 350aa    MW: 37954.5 Da    PI: 8.5659
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g30885.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.81.1e-125199148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W +eEd  l  +v+  G+  +W + +r++g++R++k+c++rw++yl
  Bradi4g30885.1.p 51 KGPWAAEEDAVLRAYVAANGTAgNWIALPRKIGLNRCGKSCRLRWLNYL 99
                      79******************99*************************97 PP

2Myb_DNA-binding408.9e-13106148246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +T eEd l+  +    G++ W+tIa  ++ gRt++++k++w++
  Bradi4g30885.1.p 106 GGFTDEEDRLICSLYVSIGSR-WSTIAGQLP-GRTDNDVKNYWNT 148
                       569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.2594699IPR017930Myb domain
SuperFamilySSF466891.35E-2448146IPR009057Homeodomain-like
SMARTSM007175.4E-950101IPR001005SANT/Myb domain
PfamPF002495.8E-115199IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-2252106IPR009057Homeodomain-like
CDDcd001672.69E-65399No hitNo description
PROSITE profilePS5129420.575100154IPR017930Myb domain
SMARTSM007171.9E-10104152IPR001005SANT/Myb domain
PfamPF002491.7E-10106148IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-22107154IPR009057Homeodomain-like
CDDcd001675.88E-8108150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MTVLSRHIII HQPAPSTQPS ASSQRPAGEP KGARDDAMGR APCCDKASVK KGPWAAEEDA  60
VLRAYVAANG TAGNWIALPR KIGLNRCGKS CRLRWLNYLR PNIRHGGFTD EEDRLICSLY  120
VSIGSRWSTI AGQLPGRTDN DVKNYWNTKL KRRLLGAGRR PIRYALAQQP RLLPAIPAAY  180
SAVERMQLSV QLQRHHLHPA GHQLQETPGL ITFHSNLASP PWPSPSPSPR QQQPGYSAGF  240
WSHFGTSSRV SVPDDHQCAW RDSSGGTATP LSSSTTTGET AAGIDSSSST PTASPAAFGC  300
EMDDEIEMLL RQIRGLEENV DGSAGSWSSA CSTPGVDSVF HDYLQEYNM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-24511547108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0632601e-120BT063260.1 Zea mays full-length cDNA clone ZM_BFc0043P16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576555.20.0PREDICTED: transcription factor RAX3-like
TrEMBLA0A0Q3LCQ90.0A0A0Q3LCQ9_BRADI; Uncharacterized protein
STRINGMLOC_5098.11e-123(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132652632
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.15e-66myb domain protein 87